PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000191575
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HB-other
Protein Properties Length: 571aa    MW: 65077.4 Da    PI: 8.2915
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000191575genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox41.62.1e-131251641857
                    HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
       Homeobox  18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                    lF +++yp++e++ +LA++l+L+e+q++ WF+ rR k+k+
  MDP0000191575 125 LFPEHKYPTEEMKSQLAEQLRLSEKQISGWFCHRRLKDKR 164
                    6999**********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-1862164IPR009057Homeodomain-like
SMARTSM003892.1E-1177169IPR001356Homeobox domain
CDDcd000862.61E-1179164No hitNo description
PfamPF000466.6E-11125164IPR001356Homeobox domain
SuperFamilySSF466893.08E-11126171IPR009057Homeodomain-like
PROSITE profilePS5007113.394126165IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MVMKKVILVT IIARITFWYC ILXVLRGEFG LFXICGNGEM IRLWRQKDWR SXICALCHAF  60
XESNELHSEE NKNSQDNNKK RKLKTPAQLM ALEKFYNGKD TSLGLCFVLL SVEPSNFSKE  120
CSFLLFPEHK YPTEEMKSQL AEQLRLSEKQ ISGWFCHRRL KDKRLSRDET QGNGRQDRSS  180
GVIQDRASGL GQDSCGSTKH GEHRFIDPRE VESRRLSGHD FAAADITRNY SSHYTERVGD  240
MENTSSESSS SLQDRFLTQN EDPYDVETSR YLTHTKGMEN MGYKPSGFLK VKGEAENAAI  300
TAVKRQLGRQ YLEDGPLLGV EFDLLPPGAF ESPIMDSGHE PSTLXNPVLR SPDISGVKGQ  360
LSPSTRYEVY NSRLNSQDSY LQQENPSIMH GFDLQEKKSS KQLRQKSTFL NNTNPFPGKN  420
SPLDIYDKPS GGXSAYNSNK KDRMRSKGYY GRKVTSEQTE PRLDEYDKFS NPKTVQRNDY  480
LKSRPSSSIE EKFDGECKAM KDYHNPLRAK MNSTDELVVT KQARVNLPQR DYAPNSFAQI  540
PPRKHQIKGI AMEMPSSFSE DETAETNSSV D
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.58870.0cell culture| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008363092.10.0PREDICTED: uncharacterized protein LOC103426792 isoform X1
TrEMBLM5WMQ70.0M5WMQ7_PRUPE; Uncharacterized protein
STRINGVIT_06s0009g03530.t011e-160(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57923051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.19e-83HB-other family protein